Save 50% Off 25x Faster SSD WooCommerce Hosting

Quanto vale il sito web ravenhawksmagickalmysticalplaces.com?

ravenhawksmagickalmysticalplaces.com

ravenhawksmagickalmysticalplaces.com

Ha un Valore Stimato di

$ 25.00 Coin


Valore Sito calcolato il: 18 settembre 2025 13:37:03   


Dati Stimati Analytics   Dati Stimati Analytics
Statistiche Stimate Giornaliere
Visite Uniche Giornaliere   Visite Uniche Giornaliere 2
Visualizzazioni Pagina Giornaliere   Visualizzazioni Pagina Giornaliere 7
Reddito Ads Giornaliero   Reddito Ads Giornaliero $ 0.02
Statistiche Stimate Mensili
Statistiche Stimate Mensili   Visitatori Unici Mensili 72
Visualizzazioni pagina Mensili   Visualizzazioni pagina Mensili 207
Reddito Ads Mensile   Reddito Ads Mensile $ 0.62
Statistiche Stimate Annuali
Visitatori Unici Annuali   Visitatori Unici Annuali 889
Visualizzazioni Pagina Annuali   Visualizzazioni Pagina Annuali 2,557
Reddito Ads Annuale   Reddito Ads Annuale $ 7.67
Informazioni di Base   Informazioni di Base
Nome Dominio ravenhawksmagickalmysticalplaces.com
Titolo

Parole chiave

Descrizione

Statistiche Motori di Ricerca   Statistiche Motori di Ricerca
Indice Google   Indice Google 0
Indice Yahoo   Indice Yahoo 0
Indice Bing   Indice Bing 0
Backlink di Google   Backlink di Google 0
Statistiche Facebook   Statistiche Facebook
Conteggio Condivisioni 0
Conto commenti 0
Commenti contano nel plugin 0
Conteggio delle reazioni 0
Conteggio Totale 0
MOZ

Domain Authority   

0.00
Page Authority   
0.00
MOZ Links   

0

Statistiche Antivirus   Statistiche Antivirus
Google   Google safe
Norton   Norton untested
Statistiche Social   Statistiche Social
Pins   Pins 0
Statistiche Posizione   Statistiche Posizione
Indirizzo IP 173.254.28.234
Paese Stati Uniti d'America Stati Uniti d'America
Regione Utah
Città Provo
Longitudine -111.643
Latitudine 40.2066
WHOIS   WHOIS
Domain Name: RAVENHAWKSMAGICKALMYSTICALPLACES.COM
Registry Domain ID: 1116999574_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enomdomains.com
Updated Date: 2025-07-28T10:03:11Z
Creation Date: 2007-07-29T00:56:37Z
Registry Expiry Date: 2026-07-29T00:56:37Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4165350123
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.JUSTHOST.COM
Name Server: NS2.JUSTHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2025-09-18T18:36:47Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

Mostra ai Tuoi Visitatori il Valore del Tuo Sito Web

Valore Stimato
• $ 25.00 •
 Ottieni Codice

Proprietario del Sito? Vendita Sito Web!

Check Your Site Value

Stima costo di qualsiasi dominio di un sito web

In totale abbiamo calcolato il prezzo di 428,962 siti web

Save 50% Off 25x Faster SSD WooCommerce Hosting